BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120216.Seq (848 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0977 - 9900073-9900521,9900594-9900698,9900770-9900959,990... 29 3.5 06_01_0236 + 1804368-1804374,1804514-1804532,1804652-1805011,180... 29 3.5 >12_01_0977 - 9900073-9900521,9900594-9900698,9900770-9900959, 9901035-9901093,9901297-9901688,9901770-9902059, 9902146-9903030 Length = 789 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +2 Query: 317 KKPRNMADAPYNVWSPLISASCLDKKATYLIDPDDFIDKLTLTPYTVFYN 466 K+ D NV +PL+ A L+ +D + DKL + P F N Sbjct: 658 KRLEGARDEVANVATPLVQAMFLNNSGPSALDATEIFDKLRVAPDVYFKN 707 >06_01_0236 + 1804368-1804374,1804514-1804532,1804652-1805011, 1805214-1805248,1805306-1805385,1805488-1805701, 1805972-1806111,1806197-1806235,1806328-1806369 Length = 311 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 758 YQCENRCLIKALTHFYNYDSNV 823 Y+ +NRCL++AL YN D N+ Sbjct: 144 YEKDNRCLVQALVEKYNDDHNL 165 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,003,040 Number of Sequences: 37544 Number of extensions: 438158 Number of successful extensions: 929 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 929 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2362209084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -