BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120213.Seq (852 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0250 + 6266818-6267029,6267230-6267287,6267999-6268118,627... 30 2.0 01_06_1593 + 38502884-38502993,38503580-38503665,38504352-385044... 30 2.7 07_01_0244 + 1786009-1788048 29 3.6 09_04_0496 + 18079905-18081586,18084825-18084868,18086396-180865... 29 4.7 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 29 4.7 01_06_1406 - 37073548-37073822,37073892-37074111,37074200-370742... 29 4.7 >09_02_0250 + 6266818-6267029,6267230-6267287,6267999-6268118, 6272359-6272511,6273381-6273586,6274280-6274733, 6276573-6276610,6276923-6277046,6277184-6277246, 6277350-6277412,6277526-6278152,6278267-6278294, 6278373-6278413,6278689-6278851,6278987-6279039, 6279217-6279262,6279373-6279444,6279578-6279741, 6279968-6280099,6280249-6280565,6280721-6280892, 6281009-6281107,6281275-6281349,6281446-6281504, 6281647-6281836,6281982-6282020 Length = 1255 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -2 Query: 722 IVLMASNNCSANLSNMSVKSGNESVISESNVFN 624 +V + SN CS NMS+KS E + ++SN F+ Sbjct: 944 VVCLGSNTCSNKTKNMSIKS--EHIYNKSNQFD 974 >01_06_1593 + 38502884-38502993,38503580-38503665,38504352-38504497, 38504817-38504933,38505028-38505144,38505858-38506001, 38506099-38506251 Length = 290 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +1 Query: 565 NQNVQLLAALETAKDVILTRLNTLLSEITDSLPDLTLMLDKLAEQLLEAINTMQQTQRNE 744 N+ + +L E D+I TRLN ++ + D L + +D +Q L + + T R E Sbjct: 206 NEPLHVLVEAEFPADIIDTRLNQAVTILEDLLKPIDESMDYYKKQQLRELAILNGTLREE 265 >07_01_0244 + 1786009-1788048 Length = 679 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 786 CSTLNWSKRVGVVQLVALRLLHRVDGFQQL 697 C TL W +R+ V++ VA LL+ D ++Q+ Sbjct: 456 CRTLGWPQRLHVIKCVAAGLLYLHDDWEQV 485 >09_04_0496 + 18079905-18081586,18084825-18084868,18086396-18086502, 18087069-18087674,18087789-18088013,18088102-18088167, 18088268-18088336,18088511-18088582,18088672-18088848, 18089978-18090115 Length = 1061 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 186 GSCHNTVKYMVDIYGAS-VLILRTLARLPTS 275 G CHN VK + IYG + +L+L LPT+ Sbjct: 546 GDCHNAVKLLSKIYGRNPLLLLAPDGPLPTA 576 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = -3 Query: 325 TTVKVAQIIVCNKCAQQLVGKRASVRKIKTDAP*MSTMYLTV 200 TTV++ + C CAQQL K +R ++T +ST LTV Sbjct: 152 TTVELLVNMHCEACAQQLHKKILKMRGVQTADTNLSTGKLTV 193 >01_06_1406 - 37073548-37073822,37073892-37074111,37074200-37074246, 37074404-37074576,37075161-37075238,37075751-37075813, 37075889-37075961,37076150-37076189,37076302-37076368, 37076719-37078472,37079128-37079230,37080041-37080078, 37080221-37080347,37081944-37082152 Length = 1088 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = -2 Query: 377 NEVCREENVISSVIVIGDDGKSSTNNCLQ*MCSATGRQTSKRSQNQNGRS 228 ++ CR E + I D S NC + C GR K+ N RS Sbjct: 561 SKACRGEEQKTQTIPKSSDNASLVENCKKESCPGKGRVQDKKKSVSNERS 610 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,735,032 Number of Sequences: 37544 Number of extensions: 398097 Number of successful extensions: 1155 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1155 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2373961368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -