BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120211.Seq (768 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13960.1 68418.m01632 SET domain-containing protein (SUVH4) i... 29 3.4 At1g19110.1 68414.m02377 inter-alpha-trypsin inhibitor heavy cha... 28 7.9 >At5g13960.1 68418.m01632 SET domain-containing protein (SUVH4) identical to SUVH4 [Arabidopsis thaliana] GI:13517749; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain; identical to cDNA SUVH4 (SUVH4) GI:13517748 Length = 624 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 445 GHQCKSGLTHSFFLYSGLYDV 507 GH CKS T + Y GLY V Sbjct: 261 GHNCKSSYTKRVYTYDGLYKV 281 >At1g19110.1 68414.m02377 inter-alpha-trypsin inhibitor heavy chain-related similar to SP|Q61704 Inter-alpha-trypsin inhibitor heavy chain H3 precursor {Mus musculus}; contains Pfam profile PF00092: von Willebrand factor type A domain Length = 754 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 168 PTIFVI*SPSDSQGTTLHIKMIITTPITFNIDQDFYE 58 P IF + P GT L IKM + +T+N Q F + Sbjct: 174 PNIFTLTIPQVDGGTNLSIKMTWSQKLTYNQGQFFLD 210 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,798,666 Number of Sequences: 28952 Number of extensions: 260424 Number of successful extensions: 477 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -