BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120210.Seq (733 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 24 1.1 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 23 1.9 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 4.4 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 90 MGYPPPCNWLFPKKK 134 +G PP WLF KKK Sbjct: 318 LGSLPPFKWLFKKKK 332 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 23.4 bits (48), Expect = 1.9 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -2 Query: 231 LLL*PLGIVVCVILEERLLFWRSEPEAFWYT-RISF*ERASCKAAGNPFN 85 LLL + ++ + L + +WR + E FW+ +SF E C+ N F+ Sbjct: 102 LLLFVINVLYVLTLCYAVYYWRQQYEDFWHRYTLSFIEN-YCQFLYNCFH 150 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 99 PPPCNWLFPKKKSWCTRRLQVH 164 P CNWLF K+ + LQ H Sbjct: 344 PFVCNWLFCGKRFTRSDELQRH 365 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,705 Number of Sequences: 336 Number of extensions: 3854 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -