BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120207X.Seq (510 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 31 0.55 SB_47411| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.73 SB_13238| Best HMM Match : rve (HMM E-Value=1.1e-13) 29 1.7 SB_28707| Best HMM Match : rve (HMM E-Value=0.011) 28 3.9 SB_24234| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_2351| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-07) 27 9.0 >SB_48350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 31.1 bits (67), Expect = 0.55 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Frame = +2 Query: 56 RRTFRC-FW-----DTK*LIQKTTFCETTLYQEQIRTLLWAAASAHWQVLRLVLFSANRR 217 RR C FW + K L C+T +Q TL+ A A W+++ +VLFS N + Sbjct: 524 RRARECIFWPGMPAEIKQLASVCDACQTFAKAQQKETLIAIEAKAPWEIVGVVLFSWNNK 583 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 31.1 bits (67), Expect = 0.55 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 349 CKHQLCSMCXXXXXXXXXXPCPLCRV 426 C+H+ C MC CP+CR+ Sbjct: 52 CEHEFCKMCFTQNVQEANLQCPMCRI 77 >SB_47411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 30.7 bits (66), Expect = 0.73 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 256 CNICFSVAEIK-NYFMQPIDRLTIIPVLELDTCKHQLC 366 C ++ +K F QP RL+ IPV+E C H +C Sbjct: 33 CQFVYASVLLKFTNFTQPCPRLSGIPVVEASVCHHIIC 70 >SB_13238| Best HMM Match : rve (HMM E-Value=1.1e-13) Length = 637 Score = 29.5 bits (63), Expect = 1.7 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Frame = +2 Query: 56 RRTFRC-FW-----DTK*LIQKTTFCETTLYQEQIRTLLWAAASAHWQVLRLVLFSANRR 217 RR C FW + K L C+T +Q +TL+ A A W+++ + LFS N + Sbjct: 450 RRARECIFWPGMSAEIKQLASVCDACQTFAKAQQKKTLITIEAKAPWEIVGVDLFSWNNK 509 >SB_28707| Best HMM Match : rve (HMM E-Value=0.011) Length = 173 Score = 28.3 bits (60), Expect = 3.9 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 6/60 (10%) Frame = +2 Query: 56 RRTFRC-FW-----DTK*LIQKTTFCETTLYQEQIRTLLWAAASAHWQVLRLVLFSANRR 217 RR C FW + K L C+T +Q TL+ A A W+++ + LFS N + Sbjct: 30 RRARECIFWPGMSAEIKQLASVCDACQTFSKAQQKETLITKEAKAPWEIVGVDLFSWNNK 89 >SB_24234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.1 bits (57), Expect = 9.0 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 285 NFCNRKTNVACNLTNSIFRRLHLRLFAENNTRRRT 181 N NR+TN+A TN ++ +L + N T R+T Sbjct: 67 NLTNRQTNLAIRQTNLTIKQTNLTIRQTNLTIRQT 101 >SB_2351| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-07) Length = 137 Score = 27.1 bits (57), Expect = 9.0 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 10/55 (18%) Frame = +1 Query: 286 KNYFMQPI--DRLTIIPVLE--------LDTCKHQLCSMCXXXXXXXXXXPCPLC 420 KNYF +P +R + PV E + C H+LC C CP C Sbjct: 40 KNYFKKPPFEERKHLCPVCEDIFVSPVQIKECGHRLCQHCYKTIWRSPEPKCPKC 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,169,015 Number of Sequences: 59808 Number of extensions: 269227 Number of successful extensions: 635 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1123894172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -