BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120207X.Seq (510 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 pr... 23 4.5 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 23 7.9 >AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.4 bits (48), Expect = 4.5 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 200 FSANRRRCSRLKMEFVKLHATFVFRLQKLKIILCN 304 FSA R C K +L +T V LQ+ +I L + Sbjct: 121 FSAGSRNCIGQKFAQYELKSTLVKLLQRFQIRLAD 155 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 22.6 bits (46), Expect = 7.9 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -1 Query: 504 CDTRHAAFNHVHNVSVYAVNVEMQT 430 C ++ NHVH+++ +A + + T Sbjct: 182 CQAQNDTSNHVHSIAKWAQDAGLST 206 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 514,112 Number of Sequences: 2352 Number of extensions: 9331 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -