BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120206.Seq (588 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52290.1 68418.m06489 hypothetical protein 27 7.0 At2g05290.1 68415.m00557 expressed protein similar to zinc finge... 27 9.3 >At5g52290.1 68418.m06489 hypothetical protein Length = 1569 Score = 27.5 bits (58), Expect = 7.0 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 282 LILKCTEFFHVLSDLAETAGILIVHALLTIALKRDRNSNC 401 L+ KCTE F+ +S+L E A + H LL ++ +C Sbjct: 440 LVEKCTEPFYGISNLDEHAPVNTSHGLLENPFQKTGARDC 479 >At2g05290.1 68415.m00557 expressed protein similar to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 383 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 360 EHERLRFRQFPLSRLTREKTQC 295 ++ER+R R F RLT EK +C Sbjct: 198 DYERIRKRCFQCQRLTHEKPRC 219 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,873,313 Number of Sequences: 28952 Number of extensions: 170721 Number of successful extensions: 343 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 343 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1161268208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -