BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120203.Seq (842 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RSV2 Cluster: Putative uncharacterized protein PY0025... 34 5.1 >UniRef50_Q7RSV2 Cluster: Putative uncharacterized protein PY00251; n=4; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY00251 - Plasmodium yoelii yoelii Length = 1026 Score = 33.9 bits (74), Expect = 5.1 Identities = 21/79 (26%), Positives = 42/79 (53%) Frame = +3 Query: 348 SMKKNMYLLIK*HFLKLDNVTNLY*KLIIQCPKHVHCAKKHVFNYYYFIFNWSKRYTVKL 527 S KN++ IK FL L +++++ K+ + K+ KK+ NY + +Y+++ Sbjct: 672 SKNKNIFDYIKMFFLSLKCISHIFEKIKLYYDKN-GTKKKYWENYNDIFYKSEWKYSMQD 730 Query: 528 NQTAILIEYKKCKQFNYNY 584 N+ ++ YK K + Y+Y Sbjct: 731 NELEYILNYKNFKSW-YDY 748 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 630,188,581 Number of Sequences: 1657284 Number of extensions: 10457210 Number of successful extensions: 21708 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 20582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21704 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 73783549980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -