BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120203.Seq (842 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U46669-4|AAQ65208.1| 557|Caenorhabditis elegans Hypothetical pr... 28 7.2 Z78065-3|CAB01517.2| 406|Caenorhabditis elegans Hypothetical pr... 28 9.5 >U46669-4|AAQ65208.1| 557|Caenorhabditis elegans Hypothetical protein C41G11.4c protein. Length = 557 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 463 FAQCTCFGH*IINFQYRFVTLSNFKKCYLMRRYIFFFI 350 F C C GH +F+Y F+T +N+ + YI F+ Sbjct: 510 FPVCQCTGHIQCSFKYYFIT-NNYSSFSIFSYYIVQFL 546 >Z78065-3|CAB01517.2| 406|Caenorhabditis elegans Hypothetical protein T09E8.4 protein. Length = 406 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -1 Query: 599 NENELIVIIELFTFFVFYKYCSLIQLYC--IAF 507 N+NE+ V+++ FVF++ S + L C IAF Sbjct: 309 NKNEIRVLVQAIVIFVFFQASSSVFLICQTIAF 341 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,611,419 Number of Sequences: 27780 Number of extensions: 278172 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2087513582 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -