BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120202.Seq (755 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_30900| Best HMM Match : Extensin_2 (HMM E-Value=0.17) 28 9.4 SB_10744| Best HMM Match : 7tm_1 (HMM E-Value=3.2e-22) 28 9.4 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +1 Query: 61 PRRHGGSPSGNRHQQFPSQASTLPISGKFQAHDVNNQQSQLVPGF 195 PR G SG+ S +P SGK Q D N+Q GF Sbjct: 1198 PRGEGEEKSGSSGSSMESSPQGMPASGKTQITDNPNKQPGFPGGF 1242 >SB_30900| Best HMM Match : Extensin_2 (HMM E-Value=0.17) Length = 473 Score = 27.9 bits (59), Expect = 9.4 Identities = 22/94 (23%), Positives = 34/94 (36%), Gaps = 6/94 (6%) Frame = +1 Query: 43 SRQHH------PPRRHGGSPSGNRHQQFPSQASTLPISGKFQAHDVNNQQSQLVPGFCA* 204 +R HH PP G + + RH A + P +G A ++ + P Sbjct: 333 TRHHHCRHPAPPPPTPGTTTADTRHHHRRHPAPSPPTTGTITADTRHHHRRHPAPSPPTP 392 Query: 205 HGFHQFSRHSRQHHPPSAITAPLVETAISNFRHR 306 +RH + HP + P TA + HR Sbjct: 393 GTITADTRHHHRRHPAPSPLTPGTITADTRHHHR 426 >SB_10744| Best HMM Match : 7tm_1 (HMM E-Value=3.2e-22) Length = 276 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +2 Query: 356 IPYSSSMAFTSLVDTLANTI 415 I Y++S+ FTSL+ T+ANT+ Sbjct: 7 ISYTASVLFTSLLSTVANTL 26 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,125,323 Number of Sequences: 59808 Number of extensions: 518409 Number of successful extensions: 1896 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1882 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -