BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120201.Seq (858 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 32 0.69 SB_36312| Best HMM Match : Ion_trans (HMM E-Value=0) 31 1.6 SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) 29 3.7 SB_35206| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.012) 29 6.4 SB_16964| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.4 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 31.9 bits (69), Expect = 0.69 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = -1 Query: 756 ILSSRKMRIKEKEQGSASRMRMKIMKKVNPRAKKRKCRIMPKAKLHRPRRMPRNEQ 589 +L ++ R KEK++ K +K RAKK K R++ + KLH R ++ Sbjct: 942 LLIEKEKREKEKQKERLREKEEKEKQKEAERAKKEKERLLQEDKLHEKEEKDRKDK 997 >SB_36312| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 1283 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/49 (40%), Positives = 24/49 (48%) Frame = +1 Query: 331 NHTRS*VTTENE*VRRHLDR*NYHSRSRTRRLSSNHARVDTMLTYAELP 477 +H RS +E+ RR+ N HS SR RR S NH LT LP Sbjct: 980 DHRRSSTRSEHSVQRRYS---NEHSPSRKRRNSDNHGHKKHSLTGVSLP 1025 >SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) Length = 787 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/44 (29%), Positives = 27/44 (61%) Frame = -1 Query: 756 ILSSRKMRIKEKEQGSASRMRMKIMKKVNPRAKKRKCRIMPKAK 625 IL R+ +E+E+ + + +R +++ K NP A+ + +I+P K Sbjct: 724 ILRQREEEREEEERRNIAMLRQQMVHKANPIARFKGVQILPSEK 767 >SB_35206| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.012) Length = 1148 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/54 (25%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 732 IKEKE-QGSASRMRMKIMKKVNPRAKKRKCRIMPKAKLHRPRRMPRNEQTAWRP 574 +K+ E Q A+ +R++++++ N + + +M A + PR+ ++ T WRP Sbjct: 822 VKDMERQVMANNIRIQLLEEQNDKLRSSITLLM-NASANAPRKTAQDPMTLWRP 874 >SB_16964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/54 (25%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 732 IKEKE-QGSASRMRMKIMKKVNPRAKKRKCRIMPKAKLHRPRRMPRNEQTAWRP 574 +K+ E Q A+ +R++++++ N + + +M A + PR+ ++ T WRP Sbjct: 17 VKDMERQVMANNIRIQLLEEQNDKLRSSITLLM-NASANAPRKTAQDPMTLWRP 69 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,954,908 Number of Sequences: 59808 Number of extensions: 394357 Number of successful extensions: 789 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 787 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2443309836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -