Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120201.Seq
         (858 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY061181-1|AAL28729.1|  158|Drosophila melanogaster LD14807p pro...    29   6.2  

>AY061181-1|AAL28729.1|  158|Drosophila melanogaster LD14807p
           protein.
          Length = 158

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = -1

Query: 696 RMKIMKKVNPRAKKRKCRIMPKAKLHRPRRMPRNEQTA 583
           R ++     PR K+R  R+ P+ + HRP+R     +TA
Sbjct: 59  RRQLPAMTAPRKKRRPRRLPPQQRRHRPKRPSLQAKTA 96


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,130,675
Number of Sequences: 53049
Number of extensions: 564896
Number of successful extensions: 1125
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1054
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1125
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4126982652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)