Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120200.Seq
         (757 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00006A0F29 Cluster: Tripartite motif-containing prot...    34   3.3  

>UniRef50_UPI00006A0F29 Cluster: Tripartite motif-containing protein
           65.; n=1; Xenopus tropicalis|Rep: Tripartite
           motif-containing protein 65. - Xenopus tropicalis
          Length = 469

 Score = 34.3 bits (75), Expect = 3.3
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 10/68 (14%)
 Frame = +2

Query: 305 FFQWTFWRIPKSYVQRLCFIFPPL----CTFTDIKQLINHRYFTFKPEAT-----LNRQN 457
           F Q   W +P+  VQR  F  P L     T T +  L+++R  TF+P +      L+RQN
Sbjct: 251 FLQQPLWHLPEPTVQRESFPCPLLPQGATTLTTLLSLLDYRNLTFEPRSANKYIQLSRQN 310

Query: 458 -KTNHTTS 478
            K +H  S
Sbjct: 311 CKASHKMS 318


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 656,735,772
Number of Sequences: 1657284
Number of extensions: 12040025
Number of successful extensions: 23252
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 22660
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23243
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 62558016040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)