BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120200.Seq (757 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 27 3.8 SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosacc... 26 6.7 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 26.6 bits (56), Expect = 3.8 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +1 Query: 571 MTSTVLL*RKKNVFFLLPTPKVRVFLPLYREESVTFSPWV 690 ++ VL+ + + L P PK+ + P+Y+ E+VT W+ Sbjct: 1200 LSKRVLIPFLTSKYHLTPIPKIDIRYPIYK-ENVTIHTWM 1238 >SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosaccharomyces pombe|chr 1|||Manual Length = 1318 Score = 25.8 bits (54), Expect = 6.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 708 RMRTCQYPGRKSHTFFP 658 R+ C+Y RKSH F+P Sbjct: 1288 RVLECEYEYRKSHDFYP 1304 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,844,015 Number of Sequences: 5004 Number of extensions: 55490 Number of successful extensions: 115 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -