BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120198.Seq (801 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 56 2e-10 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 56.4 bits (130), Expect = 2e-10 Identities = 29/83 (34%), Positives = 47/83 (56%), Gaps = 4/83 (4%) Frame = +1 Query: 499 KEFIGVAQTGSGKTLAYILPAIVHI--NNQPPIRRGD--GPIALVLAPTRELAQQIQQVA 666 ++ + AQTGSGKT A++LP I ++ + PP + P+ ++++PTRELA QI Sbjct: 196 RDLMSCAQTGSGKTAAFMLPIIHNLLSDKNPPNTENNCAQPVVVIMSPTRELAIQIADQG 255 Query: 667 ADFGHTSYVRNTCVFGGAPKREQ 735 F + S V+ ++GG Q Sbjct: 256 KKFAYNSTVKVAVIYGGTSTNHQ 278 Score = 44.0 bits (99), Expect = 1e-06 Identities = 20/56 (35%), Positives = 33/56 (58%) Frame = +2 Query: 347 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLLA 514 EV V+G + PI FE + ++ + VK GY +PT IQ P+ +SG++L++ Sbjct: 145 EVKVTGNDAPPPITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGRDLMS 200 Score = 25.8 bits (54), Expect = 0.40 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +3 Query: 753 GSRIVIATPGRLIDFL 800 G I++ATPGRL DF+ Sbjct: 285 GCHILVATPGRLKDFV 300 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,403 Number of Sequences: 336 Number of extensions: 4200 Number of successful extensions: 6 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -