BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120197.Seq (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 25 0.57 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 24 1.8 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 9.3 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 9.3 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 9.3 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 9.3 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 25.4 bits (53), Expect = 0.57 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +3 Query: 507 IDLKNLSSLESYETLKIKLALSKYMAMLSTLEMTQPLLEI 626 +DL+ E + L ++ +++KY+ L +E T+P+L I Sbjct: 84 VDLEFYLGKEWKKNLNLRDSVTKYLIHLKEIEDTEPILLI 123 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 474 IAVYNFGDRSNFVAFDTF 421 I ++ F D SNF+A +TF Sbjct: 177 INIHLFHDASNFIAMETF 194 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -3 Query: 622 SNSGWVISRVLSIAMYLLSANLIFRV 545 + G +S VLS+++ L+++LIF + Sbjct: 10 AGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -3 Query: 622 SNSGWVISRVLSIAMYLLSANLIFRV 545 + G +S VLS+++ L+++LIF + Sbjct: 10 AGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -3 Query: 622 SNSGWVISRVLSIAMYLLSANLIFRV 545 + G +S VLS+++ L+++LIF + Sbjct: 10 AGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -3 Query: 622 SNSGWVISRVLSIAMYLLSANLIFRV 545 + G +S VLS+++ L+++LIF + Sbjct: 10 AGGGGRLSSVLSLSLTSLASSLIFTI 35 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,230 Number of Sequences: 438 Number of extensions: 3769 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -