BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120193.Seq (839 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY045575-1|AAK92217.1| 4624|Homo sapiens axonemal dynein heavy c... 30 9.1 >AY045575-1|AAK92217.1| 4624|Homo sapiens axonemal dynein heavy chain DNAH5 protein. Length = 4624 Score = 30.3 bits (65), Expect = 9.1 Identities = 30/117 (25%), Positives = 48/117 (41%), Gaps = 3/117 (2%) Frame = +2 Query: 233 LPTNVLSEGVSSSQTNCQAVGH*KNISSRIQAGRFKGLQKSNMVNMPEQQSSTETAAVCK 412 L VLSE S +N +V + S++ + G F L S +T T + Sbjct: 888 LDVEVLSEEESEKISNENSVNYKNESSAKREEGNFDTLTSSINARANALLLTTVTRKKKE 947 Query: 413 NEKLLNKLES--SSYNKSNMDQLIAIV-NFLEKKNLTISST*CLSCRTNAKCPNARR 574 E L + S +N NMD L+ + N LE I S+ ++ R + N ++ Sbjct: 948 TEMLGEEARELLSHFNHQNMDALLKVTRNTLEAIRKRIHSSHTINFRDSNSASNMKQ 1004 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,999,482 Number of Sequences: 237096 Number of extensions: 2776770 Number of successful extensions: 5734 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5731 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10593928420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -