BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120193.Seq (839 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 29 0.071 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 29 0.071 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 29 0.071 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 29 0.071 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 29 0.071 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 29 0.071 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 29 0.071 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 29 0.071 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 29 0.071 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 29 0.071 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 28 0.093 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 26 0.38 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 26 0.38 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 26 0.38 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 26 0.38 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 26 0.38 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 23 3.5 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 4.6 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 4.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 4.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 4.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 4.6 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 4.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 4.6 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 4.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 4.6 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 4.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 4.6 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 8.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 8.1 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 8.1 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 8.1 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.071 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 499 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 500 K 502 + Sbjct: 118 Q 118 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.071 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 499 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 500 K 502 + Sbjct: 118 Q 118 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.071 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 499 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 500 K 502 + Sbjct: 118 Q 118 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.071 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 499 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 500 K 502 + Sbjct: 118 Q 118 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.071 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 499 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 500 K 502 + Sbjct: 118 Q 118 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.071 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 499 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 500 K 502 + Sbjct: 118 Q 118 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.071 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 499 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 500 K 502 + Sbjct: 118 Q 118 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.071 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 499 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 500 K 502 + Sbjct: 118 Q 118 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 28.7 bits (61), Expect = 0.071 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 499 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 291 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 350 Query: 500 K 502 + Sbjct: 351 Q 351 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 28.7 bits (61), Expect = 0.071 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 499 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 291 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 350 Query: 500 K 502 + Sbjct: 351 Q 351 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.3 bits (60), Expect = 0.093 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 499 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNPLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 500 K 502 + Sbjct: 118 Q 118 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.38 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 502 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.38 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 502 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.38 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 502 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.38 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 502 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.38 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +2 Query: 332 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 502 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 23.0 bits (47), Expect = 3.5 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +2 Query: 413 NEKLLNKLESSSYNKSNMDQLIAIVNFLEKKNLTISST*CLSC 541 NEK+ + + + N + DQL+A + + N I + L C Sbjct: 80 NEKISSDIVRAVLNDNEADQLLAECSPISDPNALIKISKILEC 122 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 738 KWPTDRHRLFKRQRSNSSEPK 800 +WP D L R ++S++PK Sbjct: 92 RWPGDATGLSNRSSTSSNDPK 112 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 320 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 445 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 320 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 445 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 320 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 445 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 320 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 445 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 320 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 445 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 320 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 445 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.6 bits (46), Expect = 4.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 320 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 445 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 4.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 320 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 445 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 4.6 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +1 Query: 196 EYIRANLGHFTVITDKCSKRRCVFITNELPGCWALKKYIIKNTSGSFQ 339 +Y N H+T++++ +R +TN P K N +GS Q Sbjct: 1535 QYRPINEFHWTLVSNSVKMQRRFVVTNLQPSSVYQLKVETHNVAGSNQ 1582 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 4.6 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +1 Query: 196 EYIRANLGHFTVITDKCSKRRCVFITNELPGCWALKKYIIKNTSGSFQ 339 +Y N H+T++++ +R +TN P K N +GS Q Sbjct: 1531 QYRPINEFHWTLVSNSVKMQRRFVVTNLQPSSVYQLKVETHNVAGSNQ 1578 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 8.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 747 TDRHRLFKRQRSNSSEPKKTD 809 +++HRL R +N S KTD Sbjct: 203 SEQHRLQNRLYTNDSTSSKTD 223 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 8.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 747 TDRHRLFKRQRSNSSEPKKTD 809 +++HRL R +N S KTD Sbjct: 241 SEQHRLQNRLYTNDSTSSKTD 261 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.8 bits (44), Expect = 8.1 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = +3 Query: 75 LDPKRNTSAVQGSHQHAQAHNEY 143 + P++ Q QH QAH ++ Sbjct: 179 MQPQQGQHQSQAQQQHLQAHEQH 201 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 8.1 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 499 KKELNYILNVMPVMQDERKMSKRKKKVINNN 591 KKE PV+ ++ K ++K IN++ Sbjct: 792 KKERKTATTTQPVISSRKEQKKSEEKNINDH 822 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 253,169 Number of Sequences: 438 Number of extensions: 5610 Number of successful extensions: 39 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26945694 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -