BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120192.Seq (774 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 24 4.5 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 24 6.0 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 24 6.0 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 24.2 bits (50), Expect = 4.5 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -1 Query: 153 WLNLLSPCAMRKLATRALLSFTFNRLFSSDSTDSLLCPK 37 WL S A++K A+ +S F+R+ D CP+ Sbjct: 100 WLVTASQSALQKFASTDWMSNPFDRVVCGDFAGPNGCPR 138 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 396 WHVAIRSRQHDCVLDRPQHGAAVR 467 WH A+ +R+ +L R Q AA+R Sbjct: 809 WHGALTNRECRSLLKRVQRKAAIR 832 Score = 23.4 bits (48), Expect = 7.9 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 502 CSWICAIRAPLVRTAAPCWGRSSTQSCCR 416 C + A+ +R AAP W + T CR Sbjct: 791 CRLLAAVADSTMRYAAPVWHGALTNRECR 819 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.8 bits (49), Expect = 6.0 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 493 ICAIRAPLVRTAAPCWGRSSTQSCCR 416 + A+ A ++R AP W ++ CR Sbjct: 789 LAAVAASIIRYGAPVWTEATDLQWCR 814 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 787,551 Number of Sequences: 2352 Number of extensions: 17276 Number of successful extensions: 40 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -