BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120192.Seq (774 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 27 0.19 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 27 0.19 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 25 0.78 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 25 0.78 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 25 0.78 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 25 1.0 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 24 1.4 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 3.2 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 5.5 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 27.1 bits (57), Expect = 0.19 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = -2 Query: 497 LDLRNSRTSRSDSGPVLGSIK-HTIMLSTSNRNMPLSSTVLVGVIPLNTINMDLNSLIS 324 LDLRN+ R +S L HT+ LS N+ + + + G+ LN + + N++ S Sbjct: 364 LDLRNNSIDRIESNAFLPLYNLHTLELS-DNKLRTVGAQLFNGLFVLNRLTLSGNAIAS 421 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 27.1 bits (57), Expect = 0.19 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +3 Query: 384 CRGQWHVAIRSRQHDCVLDRPQHGA--AVRTRGARIAQI 494 C G + V + S + LD P H A ++R RGA I I Sbjct: 181 CIGAFDVTLESGERVTFLDTPGHAAFISMRHRGAHITDI 219 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 25.0 bits (52), Expect = 0.78 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +2 Query: 143 KLSQMYIAEKPLSIDDIVKEGSNKVGTNSIFLGTVYD 253 K Q + KP + +V N G IFLG YD Sbjct: 487 KARQYRLNHKPFTYHIVVNSDKNVKGMVRIFLGPKYD 523 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 25.0 bits (52), Expect = 0.78 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +2 Query: 143 KLSQMYIAEKPLSIDDIVKEGSNKVGTNSIFLGTVYD 253 K Q + KP + +V N G IFLG YD Sbjct: 487 KARQYRLNHKPFTYHIVVNSDKNVKGMVRIFLGPKYD 523 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 25.0 bits (52), Expect = 0.78 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +2 Query: 143 KLSQMYIAEKPLSIDDIVKEGSNKVGTNSIFLGTVYD 253 K Q + KP + +V N G IFLG YD Sbjct: 113 KARQYRLNHKPFTYHIVVNSDKNVKGMVRIFLGPKYD 149 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 265 SPNAASTSSNVTMTRGTAN 321 S A+ TSS V +TRGT N Sbjct: 12 SSAASKTSSKVMLTRGTVN 30 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 24.2 bits (50), Expect = 1.4 Identities = 14/62 (22%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = -3 Query: 577 WSALIAVKLFSN--KTC*AASFFVYPECSWICAIRAPLVRTAAPCWGRSSTQSCCRLRIA 404 W V L+S C V+ +W+ I + + CW R ++ R+ A Sbjct: 348 WLPFFVVNLWSGFCSQCIWQEKIVFAAVTWLGWINSGMNPVIYACWSRDFRRAFVRILCA 407 Query: 403 TC 398 C Sbjct: 408 CC 409 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.0 bits (47), Expect = 3.2 Identities = 12/40 (30%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 377 VGVIPLNTINMDLNSLISKFAVPRVMVTLLDVLAAF-GDL 261 +G +P+N IN+ L I ++ +LL ++ A+ GD+ Sbjct: 72 IGSVPVNNINLILLQNIIDICWITMVYSLLGIIIAYTGDV 111 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 5.5 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Frame = +2 Query: 8 LNSLTEASPSLGQSSESVESDENK----RLNVKLNNARVANLR 124 ++SL E SS SVE EN+ LN + + R+ +LR Sbjct: 326 ISSLDEIRTRYKDSSSSVEGWENRATIPELNEEFRDLRLQDLR 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,982 Number of Sequences: 438 Number of extensions: 4755 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -