SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120189.Seq
         (731 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY645023-1|AAT92559.1|   99|Anopheles gambiae wingless protein.        28   0.34 
CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    24   5.6  

>AY645023-1|AAT92559.1|   99|Anopheles gambiae wingless protein.
          Length = 99

 Score = 27.9 bits (59), Expect = 0.34
 Identities = 12/44 (27%), Positives = 20/44 (45%)
 Frame = -3

Query: 192 LYPRRKTSRPELTSDTLFIQPSSPFCARTDRHFVRSRHNDSALD 61
           L P     +P  + D ++++PS  FC R  R  ++  H     D
Sbjct: 3   LKPYNPEHKPPGSKDLVYLEPSPGFCERNPRLGIQGTHGRQCND 46


>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative
           cytoskeletal structural protein protein.
          Length = 1645

 Score = 23.8 bits (49), Expect = 5.6
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 335 FCLLFNIVFVF 367
           FCLLFN+ F+F
Sbjct: 9   FCLLFNLYFLF 19


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 665,520
Number of Sequences: 2352
Number of extensions: 12057
Number of successful extensions: 15
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74844540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -