BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120189.Seq (731 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. 27 0.18 AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. 27 0.18 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 25 0.73 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 25 0.73 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 3.9 >AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. Length = 136 Score = 27.1 bits (57), Expect = 0.18 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = -3 Query: 192 LYPRRKTSRPELTSDTLFIQPSSPFCARTDRHFVRSRHNDSALD 61 L P +P D ++++PS PFC + + + H D Sbjct: 62 LKPYNPEHKPPGPKDLVYLEPSPPFCEKNPKLGILGTHGRQCND 105 >AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. Length = 135 Score = 27.1 bits (57), Expect = 0.18 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = -3 Query: 192 LYPRRKTSRPELTSDTLFIQPSSPFCARTDRHFVRSRHNDSALD 61 L P +P D ++++PS PFC + + + H D Sbjct: 63 LKPYNPEHKPPGPKDLVYLEPSPPFCEKNPKLGILGTHGRQCND 106 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 25.0 bits (52), Expect = 0.73 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 163 RAYFRYFIHPTIFAIL 116 RA+ R IHPT+F++L Sbjct: 32 RAFCRNCIHPTVFSVL 47 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 25.0 bits (52), Expect = 0.73 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 163 RAYFRYFIHPTIFAIL 116 RA+ R IHPT+F++L Sbjct: 480 RAFCRNCIHPTVFSVL 495 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 574 YHLLVHVLICLTNNFILSGVILINIMYCV 660 Y + +LI L I+ G ++ NI+ CV Sbjct: 36 YTVTQAILIALVLGSIIVGTVIGNILVCV 64 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,760 Number of Sequences: 438 Number of extensions: 3762 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -