BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120183.Seq (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) 31 1.3 SB_44509| Best HMM Match : EMI (HMM E-Value=4.2) 30 2.2 SB_12493| Best HMM Match : RrnaAD (HMM E-Value=4.6) 30 2.2 SB_50241| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_14072| Best HMM Match : ELO (HMM E-Value=5.7) 29 2.9 SB_38410| Best HMM Match : 7tm_1 (HMM E-Value=0) 29 5.1 SB_31237| Best HMM Match : Cathelicidins (HMM E-Value=0.58) 29 5.1 SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) 28 6.7 >SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 139 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 307 MPVMQDERKMSKRKKKVINNNKYILFNSWYTKIK 408 +PV +++ + K NN KY L WY+K++ Sbjct: 7 LPVQNQAKRLRTWRSKTRNNTKYKLICIWYSKVR 40 >SB_44509| Best HMM Match : EMI (HMM E-Value=4.2) Length = 782 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +3 Query: 15 DKCSKRK-VCLHHKRIARLLGIKKIYHQEYKRVVSKVYKNQTW*TCRSNNLLHKLRPCAK 191 D+ S RK C + +++ I+++ Q+ R +K+ K+ + TC +LR CA Sbjct: 63 DRYSTRKGACAVVQSSQKMIDIRRVRRQKSMRSCAKLSKDNRYSTCTPAEEYAQLRVCAV 122 Query: 192 MKS 200 ++S Sbjct: 123 VRS 125 >SB_12493| Best HMM Match : RrnaAD (HMM E-Value=4.6) Length = 984 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +3 Query: 15 DKCSKRK-VCLHHKRIARLLGIKKIYHQEYKRVVSKVYKNQTW*TCRSNNLLHKLRPCAK 191 D+ S RK C + +++ I+++ Q+ R +K+ K+ + TC +LR CA Sbjct: 830 DRYSTRKGACAVVQSSQKMIDIRRVRRQKSMRSCAKLSKDNRYSTCTPAEEYAQLRVCAV 889 Query: 192 MKS 200 ++S Sbjct: 890 VRS 892 >SB_50241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 2.9 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Frame = +1 Query: 271 LEKKNINYILNVMPVMQDERKMSKRKKKVINNNKY---ILFNSWYTKIKQPEWPSSPAMW 441 +E K + Y V +DE K+ RK+ + +Y ILFN++ ++ +W S + W Sbjct: 26 IEAKTMKYKYGCSDVPRDE-KLDLRKRSLYYLERYFYFILFNTYLNMERRSKWDRSFSQW 84 >SB_14072| Best HMM Match : ELO (HMM E-Value=5.7) Length = 226 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -3 Query: 375 VFIVVNHLLLAFGHFAFVLHDRHYVEDIVNVLFFQEIYNSISWSM 241 V ++ N L ++FV+ +HYV++ V LF E+ SI ++ Sbjct: 108 VLVLYNLLCSVLSLYSFVIIAKHYVQNGVESLFRMEVNQSIKQAL 152 >SB_38410| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 368 Score = 28.7 bits (61), Expect = 5.1 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -3 Query: 393 PTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVEDIVNVLF 277 P N+ +++ +L A + + HDR + E N+LF Sbjct: 313 PREVHNILLLMGYLNSALNPYMYSFHDRQFKEAFKNILF 351 >SB_31237| Best HMM Match : Cathelicidins (HMM E-Value=0.58) Length = 562 Score = 28.7 bits (61), Expect = 5.1 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 247 PANAIVNFLEKKNINYILNVMPVMQDERK 333 P ++ + EK N N ILN +P+ Q+++K Sbjct: 239 PQASVRSTYEKDNSNTILNTLPIKQEQKK 267 >SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) Length = 2110 Score = 28.3 bits (60), Expect = 6.7 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 226 LQQIQHGPANAIVNFLE--KKNINYILNVMPVMQDERKMSKRKKK 354 + +I+ P N I + ++ +NI L P+ QDE + KRKKK Sbjct: 206 VDEIEDEPINEISSLVDFVDENIEKSLLKDPLWQDEEEKGKRKKK 250 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,071,166 Number of Sequences: 59808 Number of extensions: 499123 Number of successful extensions: 1168 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1168 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -