BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120177.Seq (785 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC012305-1|AAH12305.1| 79|Homo sapiens CAPZB protein protein. 33 0.88 BC008095-1|AAH08095.1| 79|Homo sapiens CAPZB protein protein. 33 0.88 >BC012305-1|AAH12305.1| 79|Homo sapiens CAPZB protein protein. Length = 79 Score = 33.5 bits (73), Expect = 0.88 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = -2 Query: 646 RHMAHCSMKNTL*NSTFIVFNCCMTKSRLLLSRVYTISSMMRLRKCWC 503 R + CS+ ++L + T + +T R L R+ I++++RLR C+C Sbjct: 21 RKLVFCSLPSSLPSPTGHITAASLTAQRHLSLRIKPIATLLRLRACFC 68 >BC008095-1|AAH08095.1| 79|Homo sapiens CAPZB protein protein. Length = 79 Score = 33.5 bits (73), Expect = 0.88 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = -2 Query: 646 RHMAHCSMKNTL*NSTFIVFNCCMTKSRLLLSRVYTISSMMRLRKCWC 503 R + CS+ ++L + T + +T R L R+ I++++RLR C+C Sbjct: 21 RKLVFCSLPSSLPSPTGHITAASLTAQRHLSLRIKPIATLLRLRACFC 68 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,324,282 Number of Sequences: 237096 Number of extensions: 2402157 Number of successful extensions: 5009 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5005 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9590293096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -