BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120177.Seq (785 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL023838-2|CAA19505.1| 452|Caenorhabditis elegans Hypothetical ... 30 2.2 U23452-5|AAK31546.1| 304|Caenorhabditis elegans Hypothetical pr... 29 5.0 U70851-5|AAB09127.1| 305|Caenorhabditis elegans Hypothetical pr... 28 6.6 AL110478-3|CAB54348.1| 380|Caenorhabditis elegans Hypothetical ... 28 6.6 U40800-12|AAA81496.1| 88|Caenorhabditis elegans Hypothetical p... 28 8.7 >AL023838-2|CAA19505.1| 452|Caenorhabditis elegans Hypothetical protein Y43C5A.2 protein. Length = 452 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 Query: 114 YVSADTDADEPIIYFENITECLTDDQCDKFTYF 16 Y S TD F+N T L D CD+F YF Sbjct: 327 YSSTYTDLGAKFSTFDNFTGPLGKDDCDEFQYF 359 >U23452-5|AAK31546.1| 304|Caenorhabditis elegans Hypothetical protein R07G3.6 protein. Length = 304 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -1 Query: 140 VRRRPQRRCTLAPTRTPTSLLF 75 +RR+PQ TL PT TPT LF Sbjct: 159 LRRKPQSIPTLPPTTTPTPRLF 180 >U70851-5|AAB09127.1| 305|Caenorhabditis elegans Hypothetical protein M02B7.1 protein. Length = 305 Score = 28.3 bits (60), Expect = 6.6 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 536 YGVYARQKQSRFCHAAVENDEGAILQRIFHTTVRHVPRSLY 658 Y + Q S + +E DE IL+ H +RHVPR L+ Sbjct: 137 YSIIIPQSLSMEMLSRIEQDE--ILKTAKHLDIRHVPRELF 175 >AL110478-3|CAB54348.1| 380|Caenorhabditis elegans Hypothetical protein Y26D4A.8 protein. Length = 380 Score = 28.3 bits (60), Expect = 6.6 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = +3 Query: 318 VFDEIQRHSKIRGAAVDRMGH*RIPRHGLA----TVSHRIYGQN 437 +F E+Q+HS+I A V+++ R H LA T H YG + Sbjct: 285 LFKELQKHSRILYATVNKIPVVRKTNHALACVRKTTEHLAYGSS 328 >U40800-12|AAA81496.1| 88|Caenorhabditis elegans Hypothetical protein D2096.9 protein. Length = 88 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 155 IVLLVAMIPLTPLFSRYKDSYLLYSFRLIDLLRVLNRRT 271 +VL++ ++ PLF K LLYSF+ D ++N+R+ Sbjct: 11 LVLILGIVSSQPLFGLEKQ--LLYSFQDPDEFEIINKRS 47 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,524,333 Number of Sequences: 27780 Number of extensions: 400856 Number of successful extensions: 1127 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1095 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1127 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1903721438 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -