BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120177.Seq (785 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41280.1 68418.m05017 hypothetical protein contains Pfam prof... 31 1.1 At3g59240.1 68416.m06604 F-box family protein contains F-box dom... 29 4.6 At1g07900.1 68414.m00859 LOB domain protein 1 / lateral organ bo... 28 6.1 At3g44310.1 68416.m04758 nitrilase 1 (NIT1) identical to SP|P329... 28 8.1 At2g21370.2 68415.m02542 xylulose kinase, putative similar to xy... 28 8.1 At2g21370.1 68415.m02543 xylulose kinase, putative similar to xy... 28 8.1 >At5g41280.1 68418.m05017 hypothetical protein contains Pfam profile: PF01657 domain of unknown function Length = 286 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 3/74 (4%) Frame = +1 Query: 304 LYHFACLMKYKD---IQKYEVQQLIEWAINASPDMDLQQFRIEFMDKTTELNLRSCQPKS 474 +Y+F+C+++Y D + E + W+ + +F DK E+ +RS S Sbjct: 117 IYYFSCMVRYSDKFFLSTLETKPNTYWSSDDPIPKSYDKFGQRLSDKMGEVIIRSSLLSS 176 Query: 475 FTYTFTTIWDTSTF 516 ++T + DT+TF Sbjct: 177 -SFTPYYLMDTTTF 189 >At3g59240.1 68416.m06604 F-box family protein contains F-box domain Pfam:PF00646 Length = 504 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 247 FASSKSAHLTKLLSSQATYLYHFACLMKYKD 339 F +K A LT LLS + YL+ FA ++ + D Sbjct: 24 FVPTKEAALTSLLSEKWRYLFAFAPILDFDD 54 >At1g07900.1 68414.m00859 LOB domain protein 1 / lateral organ boundaries domain protein 1 (LBD1) identical to SP|Q9LQR0 LOB domain protein 1 {Arabidopsis thaliana} Length = 190 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -1 Query: 236 DETNTTNSCLCNEKKAASAVSWRLAKRSCCIC--VRRRPQRRCTLAPTRTPT 87 D + T + + ++S R+ C C +RRR RC LAP PT Sbjct: 6 DASVATTPIISSSSSPPPSLSPRVVLSPCAACKILRRRCAERCVLAPYFPPT 57 >At3g44310.1 68416.m04758 nitrilase 1 (NIT1) identical to SP|P32961 Nitrilase 1 (EC 3.5.5.1) {Arabidopsis thaliana} Length = 346 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 584 VENDEGAILQRIFHTTVRHVPRSLYER-QKVSSFYHIELIEIALDKEKY 727 V N+EG R +H + HVP R V+ H+ L+ A++KE Y Sbjct: 83 VHNEEGRDEFRKYHASAIHVPGPEVARLADVARKNHVYLVMGAIEKEGY 131 >At2g21370.2 68415.m02542 xylulose kinase, putative similar to xylulose kinase (Xylulokinase) [Bacillus subtilis] Swiss-Prot:P39211 Length = 385 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 533 RYGVYARQKQSRFCHAAVENDEGAILQRIF 622 RYGVY+ + ++ N GAIL+++F Sbjct: 223 RYGVYSHRLDDKWLVGGASNTGGAILRQLF 252 >At2g21370.1 68415.m02543 xylulose kinase, putative similar to xylulose kinase (Xylulokinase) [Bacillus subtilis] Swiss-Prot:P39211 Length = 478 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 533 RYGVYARQKQSRFCHAAVENDEGAILQRIF 622 RYGVY+ + ++ N GAIL+++F Sbjct: 316 RYGVYSHRLDDKWLVGGASNTGGAILRQLF 345 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,949,551 Number of Sequences: 28952 Number of extensions: 349077 Number of successful extensions: 1000 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 971 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1000 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1765546400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -