BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120176X.Seq (540 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC008782-1|AAH08782.1| 1219|Homo sapiens nuclear factor of kappa... 30 6.0 >BC008782-1|AAH08782.1| 1219|Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-li protein. Length = 1219 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -3 Query: 442 SRLSILTIAGLSTEHNSTPSFSVNKMGSPGMLVSLVSVPTNSILLVKL 299 S + L A EH T S S N +G+P + +L S+P ++L ++L Sbjct: 1017 SHQTALGSAFQDAEHLKTLSLSYNALGAPALARTLQSLPAGTLLHLEL 1064 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,342,381 Number of Sequences: 237096 Number of extensions: 1550584 Number of successful extensions: 3283 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3283 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5251598958 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -