BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120171.Seq (838 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19G7.10c |||topoisomerase associated protein |Schizosaccharo... 31 0.20 SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual 30 0.47 SPBC215.05 |gpd1||glycerol-3-phosphate dehydrogenase Gpd1|Schizo... 29 0.82 SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharo... 29 1.1 SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9... 27 4.4 SPAC227.11c |||sensor for misfolded ER glycoproteins Yos9 |Schiz... 26 5.8 >SPBC19G7.10c |||topoisomerase associated protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 744 Score = 31.1 bits (67), Expect = 0.20 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Frame = -3 Query: 479 PLNTINMDLNSLISKFAVPRVMVTLLDVLAAFGDLTP*SYTVPRKMLLVPTLLEPSLTMS 300 P+ + L L+S A R T L + A G + + PR++L V EP+ + S Sbjct: 384 PMQKLQQQLQRLVSS-AKERPKATQLSLEGALGKIAVNTVRTPRQLLNVKRPTEPASSNS 442 Query: 299 SID--SGFS 279 S++ SGFS Sbjct: 443 SLNNFSGFS 451 >SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1828 Score = 29.9 bits (64), Expect = 0.47 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -2 Query: 645 ELPRFSCTPECSW-ICAIRAPLVRTAAPCWGRSSTQSCCRLR 523 ++ RFS SW + +AP V + + C S ++SCC LR Sbjct: 1769 DIDRFSLKMLESWGLFENKAPFVNSTSICTAVSESRSCCHLR 1810 >SPBC215.05 |gpd1||glycerol-3-phosphate dehydrogenase Gpd1|Schizosaccharomyces pombe|chr 2|||Manual Length = 385 Score = 29.1 bits (62), Expect = 0.82 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -2 Query: 438 KVCG--AARHGHITRCAGRVWRFNSIVVYGAQKNAVSAHF 325 K+CG A HGH R R+W F + Y +K ++ F Sbjct: 39 KICGENARAHGHHFRSKVRMWVFEEEIEYKGEKRKLTEVF 78 >SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 28.7 bits (61), Expect = 1.1 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -3 Query: 377 LTP*SYTVPRKMLLVPTLLEPSLTMSSIDSGFSAIYIWLNLYRRVRCA 234 LTP +P+ ++L+P L+ L S+I SG I ++ R VR A Sbjct: 673 LTPGQLVLPKNLVLLPILILAVLKSSAIRSGSIHSDIRVSQLREVRAA 720 >SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9|Schizosaccharomyces pombe|chr 1|||Manual Length = 1223 Score = 26.6 bits (56), Expect = 4.4 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 298 DDIVKEGSNKVGTNSIFLGTVYDYGVKSPNAASTSSNVTMTR 423 D I + G NK S+ + T+ + SPN+ +T+SN T+ Sbjct: 891 DSIKRLGDNKFEDKSLRICTIPNSIFDSPNSHTTNSNSFFTK 932 >SPAC227.11c |||sensor for misfolded ER glycoproteins Yos9 |Schizosaccharomyces pombe|chr 1|||Manual Length = 322 Score = 26.2 bits (55), Expect = 5.8 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +1 Query: 301 DIVKEGSNKVGTNSIFLGTVYDYGVKSPNAASTSSNVTMTRGTANFDIKEFK 456 D +KE + K +S+F ++Y PNA+ N T ++D++E + Sbjct: 64 DSIKEKTEKTKLSSLFYAGKHEYFCVYPNASLIKQNSTT---EPSYDLQELR 112 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,467,598 Number of Sequences: 5004 Number of extensions: 72394 Number of successful extensions: 191 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 191 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 412451140 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -