BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120171.Seq (838 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024798-2|AAK29923.1| 352|Caenorhabditis elegans Hypothetical ... 29 5.4 AF101309-3|AAN60514.1| 760|Caenorhabditis elegans Hypothetical ... 28 7.2 AF101309-2|AAL32230.1| 1601|Caenorhabditis elegans Hypothetical ... 28 7.2 AF101309-1|AAL32229.1| 1680|Caenorhabditis elegans Hypothetical ... 28 7.2 >AC024798-2|AAK29923.1| 352|Caenorhabditis elegans Hypothetical protein Y48G9A.9a protein. Length = 352 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +2 Query: 119 NLNSLTEASPSLGQSSESVESDENKRLNVK-LNNARVANLRI 241 N N++ E P+ QSS E+D++ R V+ LNN +A ++ Sbjct: 17 NNNNVNEKRPASAQSSNGTETDDHHRKYVETLNNFIIATEKL 58 >AF101309-3|AAN60514.1| 760|Caenorhabditis elegans Hypothetical protein H24G06.1c protein. Length = 760 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -3 Query: 617 SAVGFAQFAHLSFGQRPRVGVDQAHNH---AVDFESQHAMSST 498 +A G LSF P + V AH+H ++DF S HA +S+ Sbjct: 491 TATGMLYIVDLSFSDTPIIDVINAHDHDVTSIDF-SDHASTSS 532 >AF101309-2|AAL32230.1| 1601|Caenorhabditis elegans Hypothetical protein H24G06.1b protein. Length = 1601 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -3 Query: 617 SAVGFAQFAHLSFGQRPRVGVDQAHNH---AVDFESQHAMSST 498 +A G LSF P + V AH+H ++DF S HA +S+ Sbjct: 491 TATGMLYIVDLSFSDTPIIDVINAHDHDVTSIDF-SDHASTSS 532 >AF101309-1|AAL32229.1| 1680|Caenorhabditis elegans Hypothetical protein H24G06.1a protein. Length = 1680 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -3 Query: 617 SAVGFAQFAHLSFGQRPRVGVDQAHNH---AVDFESQHAMSST 498 +A G LSF P + V AH+H ++DF S HA +S+ Sbjct: 491 TATGMLYIVDLSFSDTPIIDVINAHDHDVTSIDF-SDHASTSS 532 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,175,808 Number of Sequences: 27780 Number of extensions: 409641 Number of successful extensions: 1129 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1068 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1127 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2066533546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -