BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120171.Seq (838 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30260.1 68414.m03701 expressed protein 35 0.077 At5g23890.1 68418.m02806 expressed protein weak similarity to SP... 30 2.2 At2g36810.1 68415.m04514 expressed protein 29 3.8 At2g19060.1 68415.m02226 GDSL-motif lipase/hydrolase family prot... 29 5.1 >At1g30260.1 68414.m03701 expressed protein Length = 97 Score = 34.7 bits (76), Expect = 0.077 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 7/66 (10%) Frame = +1 Query: 301 DIVKEGSNKVGTNSIFLGTVYDYGVKSP-------NAASTSSNVTMTRGTANFDIKEFKS 459 D +KE +VGT+SIF + + SP + +S S++ + T G F + E + Sbjct: 31 DTIKEEEREVGTDSIFPSSFNSKKISSPFTSPYSSSVSSASASASCTSGLNKFPVTENRG 90 Query: 460 MFIVFK 477 F VFK Sbjct: 91 SFPVFK 96 >At5g23890.1 68418.m02806 expressed protein weak similarity to SP|P12957 Caldesmon (CDM) {Gallus gallus} Length = 946 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +2 Query: 107 TNALNLNSLTEASPSLGQSSESVESDENKRLNVKLNNARVANLRIAHGDI 256 T ++SLT S+ QSS+ + SDE K N + +N + + I D+ Sbjct: 120 TKKQEMHSLTSQQESMIQSSDEISSDEIKVANSEESNLKDEDKSIESNDV 169 >At2g36810.1 68415.m04514 expressed protein Length = 1071 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 4 CTT*ISLELKL*IKTNHVENRVIDRFARTDLSL 102 CTT +S+E KL I+T + +++D+F LSL Sbjct: 618 CTTLVSVEPKLTIETRNRVMKILDQFFSISLSL 650 >At2g19060.1 68415.m02226 GDSL-motif lipase/hydrolase family protein similar to family II lipases EXL6 GI:15054390, EXL1 GI:15054382, EXL2 GI:15054384 from [Arabidopsis thaliana]; contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase Length = 349 Score = 28.7 bits (61), Expect = 5.1 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +1 Query: 496 TVEDMACCDSKSTA*LCA*STPTRGRCPN-ERCANCANPTALWCTRKTRQLSKFYWKITL 672 TV D +CC +S LCA + P CPN ER N + K + F IT Sbjct: 284 TVTDKSCCTVESGQELCAANKPV---CPNRERYVYWDNVHSTEAANKVVVKAAFAGLITS 340 Query: 673 PLLML 687 P+ +L Sbjct: 341 PISIL 345 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,789,433 Number of Sequences: 28952 Number of extensions: 371022 Number of successful extensions: 920 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 920 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1931371200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -