BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120170.Seq (771 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0463 + 23879587-23879771,23879783-23881658 30 2.4 06_03_0813 - 24853119-24854480,24854711-24855442,24855556-248559... 30 2.4 >11_06_0463 + 23879587-23879771,23879783-23881658 Length = 686 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 661 DVAREPDVQFEESDNICKFYTHH 729 DVA EP ++ SDN C FY H Sbjct: 414 DVAGEPVTRYSHSDNKCTFYEGH 436 >06_03_0813 - 24853119-24854480,24854711-24855442,24855556-24855962, 24856091-24856359,24856681-24856733,24857019-24857078, 24857309-24857363,24858080-24858155,24858225-24858801 Length = 1196 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 472 QNVRVDHVDSHEREFVNQHGEFFFKEHNKIIQYLYQTIHK 591 +NV + HV ER V + G ++ + I++Y Y +HK Sbjct: 507 KNVPIPHVSPEERFLVGRIGPKEYRIYRCIVRYGYHDVHK 546 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,812,885 Number of Sequences: 37544 Number of extensions: 353686 Number of successful extensions: 911 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2075009728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -