BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120170.Seq (771 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 25 2.6 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 25 3.4 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 25.0 bits (52), Expect = 2.6 Identities = 14/55 (25%), Positives = 31/55 (56%) Frame = +1 Query: 544 KEHNKIIQYLYQTIHKIEYVDMLMDKFNDKRLFLTELRDDVAREPDVQFEESDNI 708 K+H+ I Y+ +H+++Y++M +++ K +T L V E D + ++D + Sbjct: 341 KQHSSIT---YEAVHEMKYIEMCINESMRKYPPITTLTRRV--EKDYRVPDTDKV 390 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.6 bits (51), Expect = 3.4 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 541 FKEHNKIIQYLYQTIHKIEYVDMLMD-KFNDKRLFLTELRDDVAREPDVQF 690 FK H + + L + ++ Y L+ + +L +TELRDD PD F Sbjct: 573 FKIHG-LAKTLPANLGQVTYKTSLLHLQPRQMKLVITELRDDFPTGPDPNF 622 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 767,884 Number of Sequences: 2352 Number of extensions: 14780 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -