BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120170.Seq (771 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE006464-20|AAK61252.1| 177|Homo sapiens unknown protein. 32 2.6 AF041462-1|AAB99794.1| 348|Homo sapiens I-FLICE isoform 5 protein. 31 3.5 BC036549-1|AAH36549.2| 514|Homo sapiens major facilitator super... 31 6.0 AK091896-1|BAC03767.1| 514|Homo sapiens protein ( Homo sapiens ... 31 6.0 >AE006464-20|AAK61252.1| 177|Homo sapiens unknown protein. Length = 177 Score = 31.9 bits (69), Expect = 2.6 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = +2 Query: 473 KTYVSTTLI----RTNANLLT-NTESFFLKNTTKLFSTCIKQFTKSNMLT 607 KT+ TT + T +NLLT +T F + TTKLFST + T SN+LT Sbjct: 115 KTWFPTTKLFSTEATPSNLLTGSTRGFLSRRTTKLFST---EATPSNVLT 161 >AF041462-1|AAB99794.1| 348|Homo sapiens I-FLICE isoform 5 protein. Length = 348 Score = 31.5 bits (68), Expect = 3.5 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = +2 Query: 275 KNKVSDMLHNLKCKPCRSTVSGSR---PKCKCYKKIKINRKALKVCLIADMFGNDAEL 439 + + D +N + +P + ++ S P+ ++ K+ K L +CLI D GN+ EL Sbjct: 95 QKSLKDPSNNFREEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETEL 152 >BC036549-1|AAH36549.2| 514|Homo sapiens major facilitator superfamily domain containing 4 protein. Length = 514 Score = 30.7 bits (66), Expect = 6.0 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +3 Query: 69 TDELSIYRIYHIAKMCRDVKMLKTNMAIVNYMGNCNTCQADMRV 200 T L+I ++ + CRDVK+L + MA+ C A+M++ Sbjct: 87 TSSLAISLVFAVIPFCRDVKVLASVMALAGLAMGCIDTVANMQL 130 >AK091896-1|BAC03767.1| 514|Homo sapiens protein ( Homo sapiens cDNA FLJ34577 fis, clone KIDNE2008403. ). Length = 514 Score = 30.7 bits (66), Expect = 6.0 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +3 Query: 69 TDELSIYRIYHIAKMCRDVKMLKTNMAIVNYMGNCNTCQADMRV 200 T L+I ++ + CRDVK+L + MA+ C A+M++ Sbjct: 87 TSSLAISLVFAVIPFCRDVKVLASVMALAGLAMGCIDTVANMQL 130 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,759,143 Number of Sequences: 237096 Number of extensions: 1984017 Number of successful extensions: 4613 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4613 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9311505506 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -