BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120168.Seq (679 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 23 6.7 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 23 8.9 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 23 8.9 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 23 8.9 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 23 8.9 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 23.4 bits (48), Expect = 6.7 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -2 Query: 246 NKESILNLNTALKTAMGGIILEKINHIVKTDERVIYSDHLSSLFN 112 N + ++ N AL+ G ++N I T + + HL++LFN Sbjct: 147 NCDFLMKWNGALEKRANGKEYYQMNKIKATFDTTRFYMHLTNLFN 191 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 106 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 195 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 106 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 195 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 106 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 195 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 106 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 195 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 764,090 Number of Sequences: 2352 Number of extensions: 17009 Number of successful extensions: 25 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -