BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120164.Seq (530 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z67755-6|CAA91759.1| 311|Caenorhabditis elegans Hypothetical pr... 28 3.6 U21308-18|AAB93311.1| 208|Caenorhabditis elegans Hypothetical p... 28 4.8 >Z67755-6|CAA91759.1| 311|Caenorhabditis elegans Hypothetical protein F54F7.6 protein. Length = 311 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +1 Query: 325 SIKFTYVYTIAIITRRNNSIIAKCILLIGECPSIFVRTRYFVV 453 ++ FT + T ++ R N++ +CI+ + E P F + FVV Sbjct: 48 TVVFTQLNTTNVVERLGNNLF-RCIVKVNELPRNFQHSHNFVV 89 >U21308-18|AAB93311.1| 208|Caenorhabditis elegans Hypothetical protein ZK1290.1 protein. Length = 208 Score = 27.9 bits (59), Expect = 4.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 246 IIIEGNTHECHKTLTPCSTHSDCNLC 169 + +E T ++T TP H+DC LC Sbjct: 23 VAVEETTKAANETTTPDGPHADCFLC 48 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,016,663 Number of Sequences: 27780 Number of extensions: 251104 Number of successful extensions: 678 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1049512662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -