BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120164.Seq (530 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02910.1 68418.m00234 F-box family protein similar to ribosom... 28 4.5 >At5g02910.1 68418.m00234 F-box family protein similar to ribosomal RNA apurinic site specific lyase [Triticum aestivum] GI:6505722; contains F-box domain Pfam:PF00646 Length = 458 Score = 27.9 bits (59), Expect = 4.5 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = -3 Query: 207 LTPCSTHSDCNLCREGLANCQLFDEDTIVKMRGDDGQEQEKLIRAGEAYCLALDRER 37 L P T S +L L+NC L DE + + G E +L+ E CL L + + Sbjct: 144 LIPRCTVSWTSLKNLSLSNCTLSDESFLKILSGSPLLESLELLYCAEYMCLDLSQSQ 200 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,055,207 Number of Sequences: 28952 Number of extensions: 222114 Number of successful extensions: 597 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 597 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 987020800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -