BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120159.Seq (733 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 24 1.5 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 23 1.9 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 23 2.5 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 23 2.5 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 23 3.4 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/27 (37%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = -3 Query: 572 LQLQK--FFRDFTKRRQLWQLAQRLNL 498 L+L+K F + +++ W+LA+ LNL Sbjct: 256 LELEKEFLFNAYVSKQKRWELARNLNL 282 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -3 Query: 560 KFFRDFTKRRQLWQLAQRLNLYNLDHIEMNVNFYEL 453 +F + KRR+L +LAQ++N N+ I NF+++ Sbjct: 298 RFSDESKKRRELLRLAQQVNA-NIAQITA-ANFFDI 331 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 23.0 bits (47), Expect = 2.5 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = +3 Query: 234 NYACRIKVEFYNKHDHKVDLFKRAEHVKSFAHIVEV 341 ++ +++ +F + + +LFK A+HV A+IV + Sbjct: 310 SWCYKLQEQFVTNSEVRTELFKLAQHVS--ANIVHI 343 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 23.0 bits (47), Expect = 2.5 Identities = 10/36 (27%), Positives = 22/36 (61%) Frame = +3 Query: 234 NYACRIKVEFYNKHDHKVDLFKRAEHVKSFAHIVEV 341 ++ +++ +F + + +LFK A+HV A+IV + Sbjct: 310 SWCYKLQEQFVTNSEVRTELFKLAQHVS--ANIVHI 343 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -3 Query: 419 NSDKTLSHQLVNYIFLASNYFQNCAKNFNYM 327 N ++ SH L I YFQ C F+Y+ Sbjct: 320 NEEERNSHCLGGTITRTMWYFQICGSAFSYL 350 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,061 Number of Sequences: 336 Number of extensions: 3265 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -