BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120159.Seq (733 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1006.05c |och1||alpha-1,6-mannosyltransferase Och1 |Schizosa... 28 1.6 SPAC140.04 |||conserved fungal protein|Schizosaccharomyces pombe... 27 2.8 SPBC11C11.09c |rpl502|rpl5-2, rpl5b|60S ribosomal protein L5|Sch... 26 4.8 SPAC3H5.12c |rpl501|rpl5-1, rpl5|60S ribosomal protein L5|Schizo... 26 4.8 SPCC970.02 |||mannan endo-1,6-alpha-mannosidase|Schizosaccharomy... 25 8.4 SPCC338.06c |||heat shock protein Hsp20 family|Schizosaccharomyc... 25 8.4 >SPAC1006.05c |och1||alpha-1,6-mannosyltransferase Och1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 396 Score = 27.9 bits (59), Expect = 1.6 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 174 RCEFSCWAVCWAPARRLIWQNYACRIKVEFYNKHDHKVDLFKRAEHV 314 R +F W + AP ++W+ RI E + HD K L K E V Sbjct: 273 RVQFCQWTIAAAPGHPILWE-LVRRITDETWKLHDSK-KLSKNGESV 317 >SPAC140.04 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 295 Score = 27.1 bits (57), Expect = 2.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 121 SNLFKERQDAQHKTFAKTNNVNERKL 44 SN+ K+R+D + K KT NE +L Sbjct: 73 SNIIKKRKDEERKGTLKTEQANEEEL 98 >SPBC11C11.09c |rpl502|rpl5-2, rpl5b|60S ribosomal protein L5|Schizosaccharomyces pombe|chr 2|||Manual Length = 294 Score = 26.2 bits (55), Expect = 4.8 Identities = 22/77 (28%), Positives = 33/77 (42%) Frame = -3 Query: 626 KASKNYCGHRRYETVVRILQLQKFFRDFTKRRQLWQLAQRLNLYNLDHIEMNVNFYELLF 447 KA K+ RY+T R + K D+ R++L +AQ N YN + V F Sbjct: 5 KAVKSSPYFSRYQTKYRRRREGK--TDYYARKRL--IAQAKNKYNAPKYRLVVRFSNRFV 60 Query: 446 PLTLYNDNDNSDKTLSH 396 + + N D L+H Sbjct: 61 TCQIVSSRVNGDYVLAH 77 >SPAC3H5.12c |rpl501|rpl5-1, rpl5|60S ribosomal protein L5|Schizosaccharomyces pombe|chr 1|||Manual Length = 294 Score = 26.2 bits (55), Expect = 4.8 Identities = 22/77 (28%), Positives = 33/77 (42%) Frame = -3 Query: 626 KASKNYCGHRRYETVVRILQLQKFFRDFTKRRQLWQLAQRLNLYNLDHIEMNVNFYELLF 447 KA K+ RY+T R + K D+ R++L +AQ N YN + V F Sbjct: 5 KAVKSSPYFSRYQTKYRRRREGK--TDYYARKRL--IAQAKNKYNAPKYRLVVRFSNRFV 60 Query: 446 PLTLYNDNDNSDKTLSH 396 + + N D L+H Sbjct: 61 TCQIVSSRVNGDYVLAH 77 >SPCC970.02 |||mannan endo-1,6-alpha-mannosidase|Schizosaccharomyces pombe|chr 3|||Manual Length = 442 Score = 25.4 bits (53), Expect = 8.4 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 524 WQLAQRLNLYNLDHIEMNVNFYELLFPLTLYNDND 420 WQ+ + + YN + N F++L L + DND Sbjct: 168 WQITEFNSGYNYKNTVSNGAFFQLAARLARFTDND 202 >SPCC338.06c |||heat shock protein Hsp20 family|Schizosaccharomyces pombe|chr 3|||Manual Length = 139 Score = 25.4 bits (53), Expect = 8.4 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +3 Query: 186 SCWAVCWAPARRLIWQNYACRIKVEF--YNKHDHKVDL 293 S W CW PA L + VE +K + KVDL Sbjct: 26 SAWLSCWGPALELRETEDTIEVDVEVPGIDKQNLKVDL 63 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,601,478 Number of Sequences: 5004 Number of extensions: 52662 Number of successful extensions: 181 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 181 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -