BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120158X.Seq (547 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 26 0.25 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 24 1.00 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 25.8 bits (54), Expect = 0.25 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 12 HRCAVRKLFKQANSKHVFDHFGCSSNYCFNNYVCAI 119 H+C + F N + F + C SN C N VC I Sbjct: 360 HKCTCPEGFYGKNCE--FSGYDCDSNPCQNGGVCRI 393 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 23.8 bits (49), Expect = 1.00 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 274 CR*VYKNETCQMQQSSHGHRNCK 342 C+ +K +TC ++ S H CK Sbjct: 132 CKNGWKGKTCSLKDSHCDHTTCK 154 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,192 Number of Sequences: 336 Number of extensions: 1924 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13411456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -