BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120158X.Seq (547 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 27 0.094 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 3.5 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 6.2 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 6.2 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 6.2 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 6.2 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 27.5 bits (58), Expect = 0.094 Identities = 15/51 (29%), Positives = 31/51 (60%) Frame = +2 Query: 350 DKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYMAMLSTLEMTQPLLEI 502 +++++T E E DL+ E + L ++ +++KY+ L +E T+P+L I Sbjct: 74 EELRRT-EAFEVDLEFYLGKEWKKNLNLRDSVTKYLIHLKEIEDTEPILLI 123 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.2 bits (45), Expect = 3.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 523 ECLLCSKYFQQRLGHFQGAEHSH 455 +CLLC K F Q+ +Q SH Sbjct: 63 QCLLCQKAFDQK-NLYQSHLRSH 84 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -2 Query: 498 SNSGWVISRVLSIAMYLLSANLIFRV 421 + G +S VLS+++ L+++LIF + Sbjct: 10 AGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -2 Query: 498 SNSGWVISRVLSIAMYLLSANLIFRV 421 + G +S VLS+++ L+++LIF + Sbjct: 10 AGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -2 Query: 498 SNSGWVISRVLSIAMYLLSANLIFRV 421 + G +S VLS+++ L+++LIF + Sbjct: 10 AGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -2 Query: 498 SNSGWVISRVLSIAMYLLSANLIFRV 421 + G +S VLS+++ L+++LIF + Sbjct: 10 AGGGGRLSSVLSLSLTSLASSLIFTI 35 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,718 Number of Sequences: 438 Number of extensions: 2377 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -