BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120155.Seq (777 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59295| Best HMM Match : SET (HMM E-Value=0) 28 9.7 SB_40706| Best HMM Match : Extensin_2 (HMM E-Value=7.9) 28 9.7 >SB_59295| Best HMM Match : SET (HMM E-Value=0) Length = 1230 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 685 KVSKPVNRISEIPNWSAHNYRASPLELLCE 774 K+ P NR I +SAH +A P E +C+ Sbjct: 496 KIKHPTNRTELIIFFSAHKKKAQPTEGVCD 525 >SB_40706| Best HMM Match : Extensin_2 (HMM E-Value=7.9) Length = 301 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -1 Query: 486 YIATRHHRHFYRIYPSIKYLLK*KCPNIFSVKFRHQILIY 367 YI HH Y+ YPS+ ++ + ++ +K H L+Y Sbjct: 184 YIKDTHHYPLYQGYPSLPFISRIPITTLY-IKDTHHYLLY 222 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,281,618 Number of Sequences: 59808 Number of extensions: 448987 Number of successful extensions: 769 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -