BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120155.Seq (777 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B... 26 1.1 AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B... 26 1.1 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 4.6 >AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B precursor protein. Length = 423 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = -1 Query: 570 QFVEHCTGY*NKRNMLNVLVFPFLNYCGYIATRHHRHFYR 451 +FVEH Y + + + ++ P N GY+ T +R Sbjct: 203 EFVEHSDQYAEQLSNTDYVIVPVANPDGYVYTHEQNRLWR 242 >AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B protein. Length = 423 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = -1 Query: 570 QFVEHCTGY*NKRNMLNVLVFPFLNYCGYIATRHHRHFYR 451 +FVEH Y + + + ++ P N GY+ T +R Sbjct: 203 EFVEHSDQYAEQLSNTDYVIVPVANPDGYVYTHEQNRLWR 242 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.2 bits (50), Expect = 4.6 Identities = 16/66 (24%), Positives = 28/66 (42%) Frame = +1 Query: 544 ISCAMFYKLCIATAYVSSSALFPAQAVIPSDLNSRYTIQAIETSQGIKVSKPVNRISEIP 723 +SC F+ + + LF A++ S+ S ++ K+++ NRIS Sbjct: 1004 VSCIPFFLATVVIGNLVVLNLF--LALLLSNFGSSSLSAPTADNETNKIAEAFNRISRFS 1061 Query: 724 NWSAHN 741 NW N Sbjct: 1062 NWIKMN 1067 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 784,100 Number of Sequences: 2352 Number of extensions: 16228 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -