BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120148.Seq (644 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 26 5.3 SPCC338.15 |||dolichyl-di-phosphooligosaccharide-protein glycotr... 25 7.1 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 25.8 bits (54), Expect = 5.3 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = -2 Query: 538 KSRKDSKDVVETIVMSHSDILNLKELRNKLMSNKSIDTVG--LQCLKVKCFKLGKTDLKL 365 KS + D+ E+ +IL LKE R M ++ID + ++ +K C+K+ + L Sbjct: 217 KSACEIHDLKESDSFKDHEILRLKEERTAAM--QAIDDISGTIETIKSDCYKVESENKGL 274 Query: 364 FN 359 N Sbjct: 275 IN 276 >SPCC338.15 |||dolichyl-di-phosphooligosaccharide-protein glycotransferase subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 437 Score = 25.4 bits (53), Expect = 7.1 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +2 Query: 494 HYYSFY-DVFAVFSAFLAFCSI 556 H Y +Y F+V AFL FC I Sbjct: 398 HAYPYYASCFSVLGAFLLFCGI 419 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,280,318 Number of Sequences: 5004 Number of extensions: 39132 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -