BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120148.Seq (644 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0124 - 26692731-26697046,26698749-26698827,26698899-266989... 30 1.8 03_05_0440 + 24322332-24322388,24323478-24323615,24323654-243237... 29 2.4 09_04_0588 - 18789971-18790000,18790334-18790507,18791470-187919... 28 5.5 >01_06_0124 - 26692731-26697046,26698749-26698827,26698899-26698955, 26699321-26699416 Length = 1515 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/55 (23%), Positives = 34/55 (61%) Frame = -2 Query: 520 KDVVETIVMSHSDILNLKELRNKLMSNKSIDTVGLQCLKVKCFKLGKTDLKLFNI 356 K++ +T V SH++IL L+E +NK +S+ + ++ +++ + G+ + + ++ Sbjct: 947 KELEDTKVSSHAEILALQEQKNKALSDLQQSEISIENFRME-LEQGREKISILDL 1000 >03_05_0440 + 24322332-24322388,24323478-24323615,24323654-24323736, 24325038-24325128,24326091-24326189,24326356-24326418, 24327182-24327259,24329354-24329543,24329812-24330065, 24330159-24330531,24331193-24331276,24332085-24332371, 24332495-24332542,24333194-24333220,24333951-24333987, 24334063-24334250,24334343-24334521,24334595-24334877, 24335481-24335717,24335798-24335988,24336552-24336561, 24336844-24336984,24337073-24337288,24338437-24338727, 24338852-24339025 Length = 1272 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -2 Query: 520 KDVVETIVMSHSDILNLKELRNKLMSNKSIDTV 422 KDV +T M SD+ N+ K+ SNK++DTV Sbjct: 609 KDVEKTEWMEISDLDNVSAEEGKVSSNKAMDTV 641 >09_04_0588 - 18789971-18790000,18790334-18790507,18791470-18791954, 18792912-18793266 Length = 347 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 102 YYLSHRCLKDKISGAFVSSDAP 37 YYL RC KD ++G +V AP Sbjct: 222 YYLHARCAKDVVNGLYVHGVAP 243 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,120,041 Number of Sequences: 37544 Number of extensions: 199419 Number of successful extensions: 449 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -