BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120147.Seq (745 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68341-4|CAA92767.2| 1266|Caenorhabditis elegans Hypothetical pr... 28 6.1 Z77132-6|CAB00861.3| 1406|Caenorhabditis elegans Hypothetical pr... 28 8.0 AJ276018-1|CAC81666.1| 1122|Caenorhabditis elegans putative TRP ... 28 8.0 >Z68341-4|CAA92767.2| 1266|Caenorhabditis elegans Hypothetical protein F01G4.3 protein. Length = 1266 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -3 Query: 464 NLFISKYNAIA-LIVTDDAHLLCNYHLDRVVVNAPQKV*HVDRFDSIQLNFGLVGL 300 +LF++ + + +V + A LC H R V +P K +F + FG VGL Sbjct: 309 SLFVAAHTSAGKTVVAEYAIALCQAHKTRAVYTSPIKALSNQKFRDFKQIFGDVGL 364 >Z77132-6|CAB00861.3| 1406|Caenorhabditis elegans Hypothetical protein F54D1.5 protein. Length = 1406 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/59 (23%), Positives = 34/59 (57%), Gaps = 4/59 (6%) Frame = -1 Query: 394 ITWIVLS*TLPKKS----NTLTVSILFNLILVSLACIGSNRLRAPTD*VDKFLNFQFYW 230 + +++LS L K++ L +++ +N + ++ +C+ SN + +D ++K +N YW Sbjct: 453 VDFVILSTVLQKQNLPPDEQLALTLSWNRVDLAKSCLFSNGRKWSSDVLEKAMNDALYW 511 >AJ276018-1|CAC81666.1| 1122|Caenorhabditis elegans putative TRP homologous cationchannel protein. Length = 1122 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/59 (23%), Positives = 34/59 (57%), Gaps = 4/59 (6%) Frame = -1 Query: 394 ITWIVLS*TLPKKS----NTLTVSILFNLILVSLACIGSNRLRAPTD*VDKFLNFQFYW 230 + +++LS L K++ L +++ +N + ++ +C+ SN + +D ++K +N YW Sbjct: 169 VDFVILSTVLQKQNLPPDEQLALTLSWNRVDLAKSCLFSNGRKWSSDVLEKAMNDALYW 227 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,709,643 Number of Sequences: 27780 Number of extensions: 311230 Number of successful extensions: 857 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 855 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1756472266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -