BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120143.Seq (666 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 26 0.28 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 23 3.5 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 26.2 bits (55), Expect = 0.28 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +3 Query: 375 IYSAAALRFASTQPD-KQVYFDVTADGEPLGRIVIKLNTDEVPKTARTLELCVLVKKGLG 551 IYS A L+ PD K++Y D+ ++ L R V +N E L+L L++ L Sbjct: 19 IYSVAGLKIFEANPDTKRLYDDLLSNYNRLIRPV--MNNTETLTVQLGLKLSQLIEMNLK 76 Query: 552 TRV 560 +V Sbjct: 77 NQV 79 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 314 DENPNHDTGINASANFSQWDNI 379 DE + G+ NF ++DNI Sbjct: 161 DEKSLFENGVEIGINFDKYDNI 182 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,949 Number of Sequences: 438 Number of extensions: 4214 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -