BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120140.Seq (761 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68297-2|CAA92594.3| 522|Caenorhabditis elegans Hypothetical pr... 34 0.13 U41029-3|AAF99952.2| 886|Caenorhabditis elegans Hypothetical pr... 28 6.3 >Z68297-2|CAA92594.3| 522|Caenorhabditis elegans Hypothetical protein F11A10.3 protein. Length = 522 Score = 33.9 bits (74), Expect = 0.13 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 3/70 (4%) Frame = -1 Query: 293 TL*DYLHLFIH--LLIYFR*RNDACATCGN*MHTSLFGN-LT*RNATAEIIVVYVPVHTN 123 T+ D +H F LL YF N+ C TCG +H S + +T A E++ +VP N Sbjct: 314 TIIDCMHTFCKSCLLTYFESDNNTCPTCGTFIHGSHPTHYVTYDRAVNELVNQFVPKMEN 373 Query: 122 ID*IITKTIL 93 + + KT L Sbjct: 374 NELDVRKTFL 383 >U41029-3|AAF99952.2| 886|Caenorhabditis elegans Hypothetical protein F47G3.1 protein. Length = 886 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +1 Query: 133 TGTYTTIISAVALR*VKLPNSEVCI*FPQVAQASFLYLKYINRCIN 270 +G Y+ I + L+ +K PN C +V++A+F ++ Y N ++ Sbjct: 729 SGPYSVIGKTLRLQSIKNPNQIGCYPVKKVSEATFRWVVYTNTSLS 774 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,826,464 Number of Sequences: 27780 Number of extensions: 286427 Number of successful extensions: 550 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1819579054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -