BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120139.Seq (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 4.9 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 8.6 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.2 bits (45), Expect = 4.9 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = +3 Query: 36 FSDADVVFQANANQLSHERYQAILYPLLGSTEIVPAGTGVMKISVSYDTTLKD 194 F+ A+ V+ +SH +Y+A L+ S + + S TT+ D Sbjct: 319 FAKANAVYNPIVYGISHPKYRAALFAKFPSLACAAEPSSDAVSTTSGTTTVTD 371 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -1 Query: 443 QARLRVDIVTRYSKFLYAYLHDLIYTTNW*TF 348 +AR+R + R S+ + +L ++ T W F Sbjct: 393 KARMRALNIDRVSRVFFPFLFAVLNVTYWIMF 424 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,181 Number of Sequences: 438 Number of extensions: 5219 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -