BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120138.Seq (726 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC83.11 |||triose phosphate transporter|Schizosaccharomyces po... 27 3.6 SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosa... 26 4.8 >SPBC83.11 |||triose phosphate transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 434 Score = 26.6 bits (56), Expect = 3.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -1 Query: 705 NEATCPLKISFLLTNFISFF 646 NE CP+ ++FL F++FF Sbjct: 26 NELRCPVTLTFLQFGFVAFF 45 >SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 889 Score = 26.2 bits (55), Expect = 4.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 163 YSNSIKPKLRTKPSSQSRTESFKFHFFKLFK 71 +S+ P + SSQ+ F FHF KL+K Sbjct: 309 FSSWYGPSISFLRSSQASQSLFNFHFSKLYK 339 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,312,375 Number of Sequences: 5004 Number of extensions: 38533 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 341222980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -