BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120137.Seq (728 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1091 + 23899825-23900649,23900750-23900998,23901104-239011... 30 2.2 02_04_0550 - 23795957-23796154,23796596-23796650,23797324-237973... 29 5.0 >07_03_1091 + 23899825-23900649,23900750-23900998,23901104-23901195, 23901413-23902193 Length = 648 Score = 29.9 bits (64), Expect = 2.2 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 8/52 (15%) Frame = +1 Query: 73 VRISLEKLVPACGIRTPGQSH-----RLIRIHRSCYP---ADHDDLMIYNGL 204 V + + + PA P H RL RSCY ADHDDL++ NGL Sbjct: 57 VLLQVTNITPALSGANPFSGHHGFYLRLSDSARSCYVSLHADHDDLILTNGL 108 >02_04_0550 - 23795957-23796154,23796596-23796650,23797324-23797376, 23797453-23797529,23797613-23797736,23797848-23797964, 23798439-23798547,23798724-23798829,23799043-23799106, 23799214-23799333 Length = 340 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -1 Query: 425 IDNINNLPNYISLFAHDLDW*PHGSNSWLLLFNNC 321 +D INNLPN I+ LD SN W N C Sbjct: 81 VDYINNLPNAITSVCFRLDDDLQRSNEWRESLNPC 115 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,749,815 Number of Sequences: 37544 Number of extensions: 315811 Number of successful extensions: 494 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 494 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -